|
Polymer Molecular Function Biological Process Cellular Component GTP pyrophosphokinase (2BE3:A,B) none http://www.pdb.org/pdb/explore.do?structureId=2BE3
Polymer Molecular Function Biological Process Cellular Component GTP pyrophosphokinase (2BE3:A,B) none http://www.rcsb.org/pdb/explore.do?structureId=2be3
header transferase 21-oct-05 2be3 title structure of a gtp pyrophosphokinase family protein from title 2 ... http://www.genome.ad.jp/dbget-bin/www_bget?pdb+2BE3
Protein: Putative GTP pyrophosphokinase SP1097 from Streptococcus pneumoniae [TaxId: 1313] Lineage: Root: scop; Class: Alpha and beta proteins (a+b) [53931] http://scop.mrc-lmb.cam.ac.uk/scop/pdb.cgi?sid=d2be3b1&disp=scop
86% similar to PDB: 2BE3 Structure of a GTP Pyrophosphokinase Family Protein from Streptococcus pneumoniae (E_value = 7.9E_98); Gene Protein Sequence: http://hpv-web.lanl.gov/cgi-bin/gene_id_search.cgi?dbname=ssan&gene_id=SSA_1210
Lead Contact/Editor: Title: Structure of a GTP Pyrophosphokinase Family Protein from Streptococcus pneumoniae. To be Published: Site: Midwest Center for Structural Genomics http://www.topsan.org/Proteins/MCSG/2be3
... producing significant alignments: (bits) Value ref|NP_289338.1| (p)ppGpp synthetase I (GTP pyrophosphokina... 1495 0.0 ref|YP_690070.1| GTP pyrophosphokinase ... http://bmb.med.miami.edu/blast/prerun2/EG10835.html
... ref|ZP_01825805.1| ribose-phosphate pyrophosph... 398 e-109 gi|83754370|pdb|2BE3|A ... Residues 42-165 are similar to a (KINASE GTP PYROPHOSPHOKINASE HYDROLASE TRANSFERASE SYNTHETASE ... http://hpv-web.lanl.gov/cgi-bin/gene_id_search.cgi?dbname=smit&gene_id=SMT0617
26% similar to PDB: 2be3 Chain B GTP pyrophosphokinase (E_value = 3e-04) 26% similar to PDB: 2be3 Chain A GTP pyrophosphokinase (E_value = 3e-04) Gene Protein Sequence: http://oralgen.lanl.gov/cgi-bin/gene_id_search.cgi?dbname=pgin2&gene_id=PGN_1757
2BE3 ... Name: structure of a gtp pyrophosphokinase family protein from streptococcus pneumoniae http://bioinf-services.charite.de/jail/index.php?site=show_interfaces&pdb_id=2be3
gi|83754371|pdb|2BE3|B Chain B, Structure Of A Gtp Pyrophosphokinase Family Protein From Streptococcus Pneumoniae View structure ... http://www.webtb.org/Search/BLAST/?d=full&locus=Rv1968&w=3
GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; ... Structures: PDB: 1E3H 1E3P 1VJ7 2BE3 : Reference Authors Title Journal http://www.genome.ad.jp/dbget-bin/www_bget?ec:2.7.6.5
GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; ... Structures: PDB: 1E3H 1E3P 1VJ7 2BE3 : Reference Authors Title Journal http://www.genome.jp/dbget-bin/www_bget?EC:2.7.6.5
... HQLDEEMG+IRDDIQEAQALFDPLSRKLNDGVGNSDDTDEEYR Sbjct: 181 HQLDEEMGEIRDDIQEAQALFDPLSRKLNDGVGNSDDTDEEYR 223 > gi|83754370|pdb|2BE3|A Chain A, Structure Of A Gtp Pyrophosphokinase Family ... http://www.stdgen.lanl.gov/oralgen/bacteria/smit/blast_results/SMT0617.html
2be3.pdb. transferase 21-oct-05 2be3 Cl Se Title: structure of a gtp pyrophosphokinase family protein from streptococcus pneumoniae Author: m. e. cuff, c. hatzos, a. joachimiak ... http://metallo.scripps.edu/analysis/newpdb/recent_pdb.20051209.html
|